ZBTB8 Peptide - C-terminal region
ZBTB8 Peptide - C-terminal region
Product Specifications
Product Name Alternative
ZNF916B, RP1-27O5.1, DKFZp547H154, ZBTB8B, BOZF1, FLJ90065, MGC17919
UniProt
Q8NAP8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZBTB8 Rabbit Polyclonal Antibody (orb573844) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001139192
Preservative
Lyophilized powder
AA Sequence
LSQGLRRFGLCDSCTCVTDTPDDDDDLMPINLSLVEASSESQEKSDTDND
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSM040999-01 10 µg
Recombinant Mouse Cystatin 7/CST7 Protein (His Tag)
Sign In for Pricing
View Details PKSM040999-02 50 µg
Recombinant Mouse Cystatin 7/CST7 Protein (His Tag)
Sign In for Pricing
View Details 
RC-5943-01 50 μL
Recombinant Transcription Initiation Factor IIB Antibody
Sign In for Pricing
View Details RC-5943-02 100 µL
Recombinant Transcription Initiation Factor IIB Antibody
Sign In for Pricing
View Details RC-5943-03 1 mL
Recombinant Transcription Initiation Factor IIB Antibody
Sign In for Pricing
View Details 