ZC3H12A Peptide - C-terminal region
ZC3H12A Peptide - C-terminal region
Product Specifications
Product Name Alternative
FLJ23231, MCPIP, MCPIP1, RP3-423B22.1, dJ423B22.1
UniProt
P82912
Field of Research
Infectious Disease & Virology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZC3H12A Rabbit Polyclonal Antibody (orb331189) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_789775
Preservative
Lyophilized powder
AA Sequence
FFHPERPSCPQRSVADELRANALLSPPRAPSKDKNGRRPSPSSQSSSLLT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740676-100 1x 100 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882216-500 1x 500 µL
CD50 / ICAM3 (CG106), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040676-500 1x 500 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880009-500 1x 500 µL
MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 