Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZDHHC18 Peptide - middle region

ZDHHC18 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp667O2416, DHHC18, DHHC-18

UniProt

Q9NUE0

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZDHHC18 Rabbit Polyclonal Antibody (orb578564) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115659

Preservative

Lyophilized powder

AA Sequence

FSIWSILGLSGFHTYLVASNLTTNEDIKGSWSSKRGGEASVNPYSHKSII

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACP2, 31-380aa, Human, His tag, E.coli
E53A01040 50 µg

ACP2, 31-380aa, Human, His tag, E.coli

Sign In for Pricing
View Details
Tcirg1 3'UTR GFP Stable Cell Line
TU170294 1.0 mL

Tcirg1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
SV2B (Synaptic Vesicle Glycoprotein 2B, HsT19680, KIAA0735) (MaxLight 490)
MBS6203618-01 0.1 mL

SV2B (Synaptic Vesicle Glycoprotein 2B, HsT19680, KIAA0735) (MaxLight 490)

Sign In for Pricing
View Details
SV2B (Synaptic Vesicle Glycoprotein 2B, HsT19680, KIAA0735) (MaxLight 490)
MBS6203618-02 5x 0.1 mL

SV2B (Synaptic Vesicle Glycoprotein 2B, HsT19680, KIAA0735) (MaxLight 490)

Sign In for Pricing
View Details
Human Glycoprotein 210 Gp210 ELISA Kit
MBS007040-01 48 Well

Human Glycoprotein 210 Gp210 ELISA Kit

Sign In for Pricing
View Details
Human Glycoprotein 210 Gp210 ELISA Kit
MBS007040-02 96 Well

Human Glycoprotein 210 Gp210 ELISA Kit

Sign In for Pricing
View Details