Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZDHHC21 Peptide - middle region

ZDHHC21 Peptide - middle region

Product Specifications

Product Name Alternative

DNZ1, DHHC-21, HSPC097, 9130404H11Rik

UniProt

Q5RB84

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZDHHC21 Rabbit Polyclonal Antibody (orb582885) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_848661

Preservative

Lyophilized powder

AA Sequence

ELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-EGFR Antibody (pY1016)
F48552-0.4ML 0.4 mL

Phospho-EGFR Antibody (pY1016)

Sign In for Pricing
View Details
PCDH19 (NM_001184880) Human Over-expression Lysate
LC433660 20 µg

PCDH19 (NM_001184880) Human Over-expression Lysate

Sign In for Pricing
View Details
Carbazeran-d4
TRC-C175792-1MG 1 mg

Carbazeran-d4

Sign In for Pricing
View Details
Atp2c2 Mouse Gene Knockout Kit (CRISPR)
KN501784 1 Kit

Atp2c2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Biotin Anti-Mouse TCRβ Antibody[H57-597]
E-AB-F1123B-01 25 µg

Biotin Anti-Mouse TCRβ Antibody[H57-597]

Sign In for Pricing
View Details
Biotin Anti-Mouse TCRβ Antibody[H57-597]
E-AB-F1123B-02 100 µg

Biotin Anti-Mouse TCRβ Antibody[H57-597]

Sign In for Pricing
View Details