ZDHHC21 Peptide - middle region
ZDHHC21 Peptide - middle region
Product Specifications
Product Name Alternative
DNZ1, DHHC-21, HSPC097, 9130404H11Rik
UniProt
Q5RB84
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZDHHC21 Rabbit Polyclonal Antibody (orb582885) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_848661
Preservative
Lyophilized powder
AA Sequence
ELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GP-4801-30 1 mL
Colloidal Gold Conjugated Vicia faba Lectin (Fava Bean) -VFA- 30nm
Sign In for Pricing
View Details 
HP221298 200 Reactions
LOC284289 Human qPCR Primer Pair (XM_209105)
Sign In for Pricing
View Details 
HA723789 100 µL
Human Endostatin Recombinant Rabbit monoclonal Antibody
Sign In for Pricing
View Details