Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZDHHC21 Peptide - middle region

ZDHHC21 Peptide - middle region

Product Specifications

Product Name Alternative

DNZ1, DHHC-21, HSPC097, 9130404H11Rik

UniProt

Q5RB84

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZDHHC21 Rabbit Polyclonal Antibody (orb582885) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_848661

Preservative

Lyophilized powder

AA Sequence

ELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FPRL1 (FPR2) (Extracell. Dom) Mouse Monoclonal Antibody [Clone ID: 3D7]
AM32959PU-N 500 µg

FPRL1 (FPR2) (Extracell. Dom) Mouse Monoclonal Antibody [Clone ID: 3D7]

Sign In for Pricing
View Details
4-Ethylphenyl Sulfate Potassium Salt
TRC-E925865-250MG 250 mg

4-Ethylphenyl Sulfate Potassium Salt

Sign In for Pricing
View Details
Corticosterone Chemiluminescent ELISA Kit
K014-C5 5 Plates

Corticosterone Chemiluminescent ELISA Kit

Sign In for Pricing
View Details
Human TULP1 activation kit by CRISPRa
GA105017 1 Kit

Human TULP1 activation kit by CRISPRa

Sign In for Pricing
View Details
Human RBM17 activation kit by CRISPRa
GA113820 1 Kit

Human RBM17 activation kit by CRISPRa

Sign In for Pricing
View Details
FAM83F Human qPCR Primer Pair (NM_138435)
HP216985 200 Reactions

FAM83F Human qPCR Primer Pair (NM_138435)

Sign In for Pricing
View Details