Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZER1 Peptide - middle region

ZER1 Peptide - middle region

Product Specifications

Product Name Alternative

C9orf60, Hzyg, RP11-545E17.4, ZYG, ZYG11BL

UniProt

Q7Z7L7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZER1 Rabbit Polyclonal Antibody (orb326292) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006327

Preservative

Lyophilized powder

AA Sequence

LTNSEYRSEQSVKLRRQVIQVVLNGMESYQEVTVQRNCCLTLCNFSIPEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Tumor susceptibility gene 101 protein, TSG101 ELISA Kit
MBS9334987-01 48 Well

Rat Tumor susceptibility gene 101 protein, TSG101 ELISA Kit

Sign In for Pricing
View Details
Rat Tumor susceptibility gene 101 protein, TSG101 ELISA Kit
MBS9334987-02 96 Well

Rat Tumor susceptibility gene 101 protein, TSG101 ELISA Kit

Sign In for Pricing
View Details
Rat Tumor susceptibility gene 101 protein, TSG101 ELISA Kit
MBS9334987-03 5x 96 Well

Rat Tumor susceptibility gene 101 protein, TSG101 ELISA Kit

Sign In for Pricing
View Details
Rat Tumor susceptibility gene 101 protein, TSG101 ELISA Kit
MBS9334987-04 10x 96 Well

Rat Tumor susceptibility gene 101 protein, TSG101 ELISA Kit

Sign In for Pricing
View Details
IFT46 rabbit pAb
RA32771-01 50 µL

IFT46 rabbit pAb

Sign In for Pricing
View Details
IFT46 rabbit pAb
RA32771-02 100 µL

IFT46 rabbit pAb

Sign In for Pricing
View Details