ZER1 Peptide - middle region
ZER1 Peptide - middle region
Product Specifications
Product Name Alternative
C9orf60, Hzyg, RP11-545E17.4, ZYG, ZYG11BL
UniProt
Q7Z7L7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZER1 Rabbit Polyclonal Antibody (orb326292) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_006327
Preservative
Lyophilized powder
AA Sequence
LTNSEYRSEQSVKLRRQVIQVVLNGMESYQEVTVQRNCCLTLCNFSIPEE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1178537-01 0.02 mg (E-Coli)
Recombinant Xenopus laevis Probable RNA polymerase II nuclear localization protein SLC7A6OS (slc7a6os)
Sign In for Pricing
View Details MBS1178537-02 0.02 mg (Yeast)
Recombinant Xenopus laevis Probable RNA polymerase II nuclear localization protein SLC7A6OS (slc7a6os)
Sign In for Pricing
View Details MBS1178537-03 0.1 mg (E-Coli)
Recombinant Xenopus laevis Probable RNA polymerase II nuclear localization protein SLC7A6OS (slc7a6os)
Sign In for Pricing
View Details MBS1178537-04 0.1 mg (Yeast)
Recombinant Xenopus laevis Probable RNA polymerase II nuclear localization protein SLC7A6OS (slc7a6os)
Sign In for Pricing
View Details MBS1178537-05 0.02 mg (Baculovirus)
Recombinant Xenopus laevis Probable RNA polymerase II nuclear localization protein SLC7A6OS (slc7a6os)
Sign In for Pricing
View Details