Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp113 Peptide - middle region

Zfp113 Peptide - middle region

Product Specifications

Product Name Alternative

4732456B05Rik, KIAA4229, mKIAA4229

UniProt

Q8C689

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zfp113 Rabbit Polyclonal Antibody (orb325585) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062721

Preservative

Lyophilized powder

AA Sequence

PHKCDECSKSFNRTSDLIQHQRIHTGEKPYECSECGKAFSQSAHLIQHQR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CA7  (3B7)
YF-MA12226 100 ug

Anti-CA7 (3B7)

Sign In for Pricing
View Details
Monkey Cleft lip and palate transmembrane protein 1-like protein (CLPTM1L) ELISA Kit
MBS7230915-01 48 Well

Monkey Cleft lip and palate transmembrane protein 1-like protein (CLPTM1L) ELISA Kit

Sign In for Pricing
View Details
Monkey Cleft lip and palate transmembrane protein 1-like protein (CLPTM1L) ELISA Kit
MBS7230915-02 96 Well

Monkey Cleft lip and palate transmembrane protein 1-like protein (CLPTM1L) ELISA Kit

Sign In for Pricing
View Details
Monkey Cleft lip and palate transmembrane protein 1-like protein (CLPTM1L) ELISA Kit
MBS7230915-03 5x 96 Well

Monkey Cleft lip and palate transmembrane protein 1-like protein (CLPTM1L) ELISA Kit

Sign In for Pricing
View Details
Monkey Cleft lip and palate transmembrane protein 1-like protein (CLPTM1L) ELISA Kit
MBS7230915-04 10x 96 Well

Monkey Cleft lip and palate transmembrane protein 1-like protein (CLPTM1L) ELISA Kit

Sign In for Pricing
View Details
REG3A Recombinant Protein (Mouse)
RP167546 100 µg

REG3A Recombinant Protein (Mouse)

Sign In for Pricing
View Details