Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp113 Peptide - middle region

Zfp113 Peptide - middle region

Product Specifications

Product Name Alternative

4732456B05Rik, KIAA4229, mKIAA4229

UniProt

Q8C689

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zfp113 Rabbit Polyclonal Antibody (orb325585) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062721

Preservative

Lyophilized powder

AA Sequence

PHKCDECSKSFNRTSDLIQHQRIHTGEKPYECSECGKAFSQSAHLIQHQR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JWG-071
C01935 5 mg

JWG-071

Sign In for Pricing
View Details
Tcf21 sgRNA CRISPR Lentivector set (Mouse)
K3772501 3x 1.0 µg

Tcf21 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Monkey Apolipoprotein D ELISA Kit
MBS031168-01 48 Well

Monkey Apolipoprotein D ELISA Kit

Sign In for Pricing
View Details
Monkey Apolipoprotein D ELISA Kit
MBS031168-02 96 Well

Monkey Apolipoprotein D ELISA Kit

Sign In for Pricing
View Details
Monkey Apolipoprotein D ELISA Kit
MBS031168-03 5x 96 Well

Monkey Apolipoprotein D ELISA Kit

Sign In for Pricing
View Details
Monkey Apolipoprotein D ELISA Kit
MBS031168-04 10x 96 Well

Monkey Apolipoprotein D ELISA Kit

Sign In for Pricing
View Details