Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp192 Peptide - middle region

Zfp192 Peptide - middle region

Product Specifications

Product Name Alternative

2510038J07Rik, D430019P06Rik, LD5-1, Zfp192

UniProt

Q8BSL0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zfp192 Rabbit Polyclonal Antibody (orb576320) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_631880

Preservative

Lyophilized powder

AA Sequence

SQKPTPSQKGSSGDQEVTARLLTAGFQTLERIEDMAVSLIREEWLLDPSQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBS1 antibody
MBS5309679-01 0.05 mg

NBS1 antibody

Sign In for Pricing
View Details
NBS1 antibody
MBS5309679-02 5x 0.05 mg

NBS1 antibody

Sign In for Pricing
View Details
Hibadh Rat shRNA Plasmid (Locus ID 63938)
TL710618 1 Kit

Hibadh Rat shRNA Plasmid (Locus ID 63938)

Sign In for Pricing
View Details
Orforglipron Impurity 23
RM-O493023-01 10 mg

Orforglipron Impurity 23

Sign In for Pricing
View Details
Orforglipron Impurity 23
RM-O493023-02 25 mg

Orforglipron Impurity 23

Sign In for Pricing
View Details
Orforglipron Impurity 23
RM-O493023-03 50 mg

Orforglipron Impurity 23

Sign In for Pricing
View Details