Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp192 Peptide - middle region

Zfp192 Peptide - middle region

Product Specifications

Product Name Alternative

2510038J07Rik, D430019P06Rik, LD5-1, Zfp192

UniProt

Q8BSL0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zfp192 Rabbit Polyclonal Antibody (orb576320) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_631880

Preservative

Lyophilized powder

AA Sequence

SQKPTPSQKGSSGDQEVTARLLTAGFQTLERIEDMAVSLIREEWLLDPSQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ms4a3 3'UTR Luciferase Stable Cell Line
TU113501 1.0 mL

Ms4a3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Active Calpain 1 (CAPN1)
MBS2161969-01 0.01 mg

Active Calpain 1 (CAPN1)

Sign In for Pricing
View Details
Active Calpain 1 (CAPN1)
MBS2161969-02 0.05 mg

Active Calpain 1 (CAPN1)

Sign In for Pricing
View Details
Active Calpain 1 (CAPN1)
MBS2161969-03 0.1 mg

Active Calpain 1 (CAPN1)

Sign In for Pricing
View Details
Active Calpain 1 (CAPN1)
MBS2161969-04 0.2 mg

Active Calpain 1 (CAPN1)

Sign In for Pricing
View Details
Active Calpain 1 (CAPN1)
MBS2161969-05 0.5 mg

Active Calpain 1 (CAPN1)

Sign In for Pricing
View Details