Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp275 Peptide - middle region

Zfp275 Peptide - middle region

Product Specifications

Product Name Alternative

5430431L06Rik, AI593314, DXBay20, DXHXS52, DXPas8

UniProt

A2AIE7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zfp275 Rabbit Polyclonal Antibody (orb580214) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_113682

Preservative

Lyophilized powder

AA Sequence

LAEHQRIHSGAKPYGCPHCGKLFRRSSELTKHRRIHTGEKPYECNQCGKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Granulibacter bethesdensis Serine--tRNA ligase (serS)
MBS1428434-01 0.02 mg (E-Coli)

Recombinant Granulibacter bethesdensis Serine--tRNA ligase (serS)

Sign In for Pricing
View Details
Recombinant Granulibacter bethesdensis Serine--tRNA ligase (serS)
MBS1428434-02 0.02 mg (Yeast)

Recombinant Granulibacter bethesdensis Serine--tRNA ligase (serS)

Sign In for Pricing
View Details
Recombinant Granulibacter bethesdensis Serine--tRNA ligase (serS)
MBS1428434-03 0.1 mg (E-Coli)

Recombinant Granulibacter bethesdensis Serine--tRNA ligase (serS)

Sign In for Pricing
View Details
Recombinant Granulibacter bethesdensis Serine--tRNA ligase (serS)
MBS1428434-04 0.1 mg (Yeast)

Recombinant Granulibacter bethesdensis Serine--tRNA ligase (serS)

Sign In for Pricing
View Details
Recombinant Granulibacter bethesdensis Serine--tRNA ligase (serS)
MBS1428434-05 0.02 mg (Baculovirus)

Recombinant Granulibacter bethesdensis Serine--tRNA ligase (serS)

Sign In for Pricing
View Details
Recombinant Granulibacter bethesdensis Serine--tRNA ligase (serS)
MBS1428434-06 0.02 mg (Mammalian-Cell)

Recombinant Granulibacter bethesdensis Serine--tRNA ligase (serS)

Sign In for Pricing
View Details