Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp275 Peptide - middle region

Zfp275 Peptide - middle region

Product Specifications

Product Name Alternative

5430431L06Rik, AI593314, DXBay20, DXHXS52, DXPas8

UniProt

A2AIE7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zfp275 Rabbit Polyclonal Antibody (orb580214) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_113682

Preservative

Lyophilized powder

AA Sequence

LAEHQRIHSGAKPYGCPHCGKLFRRSSELTKHRRIHTGEKPYECNQCGKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MADCAM1 ELISA Kit (Rat) (OKEH04213)
OKEH04213 96 Well

MADCAM1 ELISA Kit (Rat) (OKEH04213)

Sign In for Pricing
View Details
Sdc4 ORF Vector (Mouse) (pORF)
ORF056805 1.0 µg DNA

Sdc4 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
PEG10 Recombinant Protein Antigen
NBP2-48592PEP 0.1 mL

PEG10 Recombinant Protein Antigen

Sign In for Pricing
View Details
Anti-STC1 Polyclonal Antibody
PHE95601 100 μg

Anti-STC1 Polyclonal Antibody

Sign In for Pricing
View Details
TRAF6BP Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-13671R-APC-Cy5.5 100 µL

TRAF6BP Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Pacific Blue™ anti-mouse CD69
GT01133 25 µg

Pacific Blue™ anti-mouse CD69

Sign In for Pricing
View Details