Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp275 Peptide - middle region

Zfp275 Peptide - middle region

Product Specifications

Product Name Alternative

5430431L06Rik, AI593314, DXBay20, DXHXS52, DXPas8

UniProt

A2AIE7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zfp275 Rabbit Polyclonal Antibody (orb580214) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_113682

Preservative

Lyophilized powder

AA Sequence

LAEHQRIHSGAKPYGCPHCGKLFRRSSELTKHRRIHTGEKPYECNQCGKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal LRRC61 Antibody
NBP1-82021-25ul 25 µL

Rabbit Polyclonal LRRC61 Antibody

Sign In for Pricing
View Details
LMNA Antibody
E45M22251G-4 50 µL

LMNA Antibody

Sign In for Pricing
View Details
DGCR8 Protein Vector (Human) (pPB-N-His)
PV012274 500 ng

DGCR8 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Rat ELN-Elastin- ELISA Kit
E-EL-R0004-01 24 Tests

Rat ELN-Elastin- ELISA Kit

Sign In for Pricing
View Details
Rat ELN-Elastin- ELISA Kit
E-EL-R0004-02 48 Tests

Rat ELN-Elastin- ELISA Kit

Sign In for Pricing
View Details
Rat ELN-Elastin- ELISA Kit
E-EL-R0004-03 96 Tests

Rat ELN-Elastin- ELISA Kit

Sign In for Pricing
View Details