Zfp275 Peptide - middle region
Zfp275 Peptide - middle region
Product Specifications
Product Name Alternative
5430431L06Rik, AI593314, DXBay20, DXHXS52, DXPas8
UniProt
A2AIE7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Zfp275 Rabbit Polyclonal Antibody (orb580214) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_113682
Preservative
Lyophilized powder
AA Sequence
LAEHQRIHSGAKPYGCPHCGKLFRRSSELTKHRRIHTGEKPYECNQCGKA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
CRB2115004 50 µg
AF488 Anti-Peroxiredoxin SO2/3 antibody - 0.65mg/mL
Sign In for Pricing
View Details 
A06269-1-Fluoro488 100 µg/Vial
Anti-GPR35 Antibody Picoband® Fluoro488 Conjugated
Sign In for Pricing
View Details ![CD22 Mouse Monoclonal Capture Antibody [Clone ID: OTI1E9]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
TA600285 100 µg
CD22 Mouse Monoclonal Capture Antibody [Clone ID: OTI1E9]
Sign In for Pricing
View Details K1888903 1.0 µg DNA
RPL7P3 sgRNA CRISPR Lentivector (Human) (Target 2)
Sign In for Pricing
View Details