Zfp444 Peptide - C-terminal region
Zfp444 Peptide - C-terminal region
Product Specifications
Product Name Alternative
2810031J10Rik, 6230401O10Rik, FLJ00134, mFLJ00134
UniProt
Q3TDV8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Zfp444 Rabbit Polyclonal Antibody (orb324695) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_082592
Preservative
Lyophilized powder
AA Sequence
PFACWECGKGFGRREHVLRHQRIHGRAAAVAQGTSAPGPEGGGAFPPWAL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7270875-01 48 Well
Goat glycolized acetylcholinesterase ELISA Kit
Sign In for Pricing
View Details MBS7270875-02 96 Well
Goat glycolized acetylcholinesterase ELISA Kit
Sign In for Pricing
View Details MBS7270875-03 5x 96 Well
Goat glycolized acetylcholinesterase ELISA Kit
Sign In for Pricing
View Details MBS7270875-04 10x 96 Well
Goat glycolized acetylcholinesterase ELISA Kit
Sign In for Pricing
View Details 
T9155-04B 100 µL
Tubulin, beta 3 (CT) (Tubulin beta III, Tubulin beta 3 Chain, TUBB 3, TUBB3, Neuron Specific beta III Tubulin, beta-4, MC1R, Tubulin beta 4, TUBB 4, TUBB4) discontinued
Sign In for Pricing
View Details