Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp445 Peptide - middle region

Zfp445 Peptide - middle region

Product Specifications

Product Name Alternative

AW610627, ZNF168, mszf29, mszf50, Znf445

UniProt

Q8R2V3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zfp445 Rabbit Polyclonal Antibody (orb324716) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775540

Preservative

Lyophilized powder

AA Sequence

KLHHKEVYKQEKRQEDFKQSYRQSQVISTVEKTFPCQNCGKTFTQKKSLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GUCY1A2 (NM_000855) Human Over-expression Lysate
LY424486 100 µg

GUCY1A2 (NM_000855) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: rectosigmoid
CS713591 5x 5 µm

Tissue FFPE Sections, Colon: rectosigmoid

Sign In for Pricing
View Details
CD3e, Mouse (145-2C11), CF568 conjugate, 0.1mg/mL
BNC682013-500 1x 500 µL

CD3e, Mouse (145-2C11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
L-Leucyl-L-tyrosine
TRC-L330183-50MG 50 mg

L-Leucyl-L-tyrosine

Sign In for Pricing
View Details
AGR3 Antibody (Biotin)
KB-8143-01 50 μL

AGR3 Antibody (Biotin)

Sign In for Pricing
View Details
AGR3 Antibody (Biotin)
KB-8143-02 100 µL

AGR3 Antibody (Biotin)

Sign In for Pricing
View Details