Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp445 Peptide - middle region

Zfp445 Peptide - middle region

Product Specifications

Product Name Alternative

AW610627, ZNF168, mszf29, mszf50, Znf445

UniProt

Q8R2V3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zfp445 Rabbit Polyclonal Antibody (orb324716) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775540

Preservative

Lyophilized powder

AA Sequence

KLHHKEVYKQEKRQEDFKQSYRQSQVISTVEKTFPCQNCGKTFTQKKSLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CELA3B (CELA3B/1218), CF647 conjugate, 0.1mg/mL
BNC471218-500 1x 500 µL

CELA3B (CELA3B/1218), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FBP2 Mouse Monoclonal Antibody [Clone ID: AT1E11]
AM50022PU-N 100 µL

FBP2 Mouse Monoclonal Antibody [Clone ID: AT1E11]

Sign In for Pricing
View Details
KHSRP Mouse Monoclonal Antibody [A7-B0]
EM1701-97 100 µL

KHSRP Mouse Monoclonal Antibody [A7-B0]

Sign In for Pricing
View Details
Bcl-X (Apoptosis Marker) (BCL2L1/1762), CF640R conjugate, 0.1mg/mL
BNC401762-100 1x 100 µL

Bcl-X (Apoptosis Marker) (BCL2L1/1762), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KIAA1310 (KANSL3) (Center) Rabbit Polyclonal Antibody
AP52348PU-N 400 µL

KIAA1310 (KANSL3) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OR2J2 Antibody
8G553-AAT 50 µg

OR2J2 Antibody

Sign In for Pricing
View Details