Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp580 Peptide - middle region

Zfp580 Peptide - middle region

Product Specifications

Product Name Alternative

1500015O20Rik, AI838225, Znf580

UniProt

Q9DB38

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zfp580 Rabbit Polyclonal Antibody (orb324404) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_081176

Preservative

Lyophilized powder

AA Sequence

ANGVPYTYTVQLEEEPRGPPQREATPGEPGPRKGYSCPECARVFASPLRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMD2 3'UTR GFP Stable Cell Line
TU064376 1.0 mL

MMD2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
WAC Rabbit Polyclonal Antibody
TA362616 100 µL

WAC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Dclre1c (NM_146114) Mouse Tagged ORF Clone Lentiviral Particle
MR222162L3V 200 µL

Dclre1c (NM_146114) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Olr180 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
34194116 3x 1.0 µg

Olr180 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
GSH (Glutathione) ELISA Kit
MBS2511936-01 24 Tests (Limit 1)

GSH (Glutathione) ELISA Kit

Sign In for Pricing
View Details
GSH (Glutathione) ELISA Kit
MBS2511936-02 48 Tests

GSH (Glutathione) ELISA Kit

Sign In for Pricing
View Details