Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp580 Peptide - middle region

Zfp580 Peptide - middle region

Product Specifications

Product Name Alternative

1500015O20Rik, AI838225, Znf580

UniProt

Q9DB38

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zfp580 Rabbit Polyclonal Antibody (orb324404) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_081176

Preservative

Lyophilized powder

AA Sequence

ANGVPYTYTVQLEEEPRGPPQREATPGEPGPRKGYSCPECARVFASPLRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TMEM52B Antibody Picoband® (Dylight488 Conjugate)
A17417-1-Dylight488 100 µg

Anti-TMEM52B Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Rat N-Acetylgalactosaminidase Alpha (Naga) ELISA Kit
EKU12585 96 Tests

Rat N-Acetylgalactosaminidase Alpha (Naga) ELISA Kit

Sign In for Pricing
View Details
EMD Antibody, FITC conjugated
MBS7048095-01 0.05 mg

EMD Antibody, FITC conjugated

Sign In for Pricing
View Details
EMD Antibody, FITC conjugated
MBS7048095-02 0.1 mg

EMD Antibody, FITC conjugated

Sign In for Pricing
View Details
EMD Antibody, FITC conjugated
MBS7048095-03 5x 0.1 mg

EMD Antibody, FITC conjugated

Sign In for Pricing
View Details
IQGAP2 Recombinant Protein Antigen
NBP2-37885PEP 0.1 mL

IQGAP2 Recombinant Protein Antigen

Sign In for Pricing
View Details