Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp583 Peptide - middle region

Zfp583 Peptide - middle region

Product Specifications

Product Name Alternative

BC056221, Znf583

UniProt

Q3V080

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zfp583 Rabbit Polyclonal Antibody (orb325600) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001028421

Preservative

Lyophilized powder

AA Sequence

ECRKAFSQNAHLAQHQRVHTGEKPYQCKECKKAFSQIAHLTQHQRIHTGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Vibrio vulnificus UPF0350 protein VV2841 (VV2841)
MBS1300070-01 0.02 mg (E-Coli)

Recombinant Vibrio vulnificus UPF0350 protein VV2841 (VV2841)

Sign In for Pricing
View Details
Recombinant Vibrio vulnificus UPF0350 protein VV2841 (VV2841)
MBS1300070-02 0.1 mg (E-Coli)

Recombinant Vibrio vulnificus UPF0350 protein VV2841 (VV2841)

Sign In for Pricing
View Details
Recombinant Vibrio vulnificus UPF0350 protein VV2841 (VV2841)
MBS1300070-03 0.02 mg (Yeast)

Recombinant Vibrio vulnificus UPF0350 protein VV2841 (VV2841)

Sign In for Pricing
View Details
Recombinant Vibrio vulnificus UPF0350 protein VV2841 (VV2841)
MBS1300070-04 0.1 mg (Yeast)

Recombinant Vibrio vulnificus UPF0350 protein VV2841 (VV2841)

Sign In for Pricing
View Details
Recombinant Vibrio vulnificus UPF0350 protein VV2841 (VV2841)
MBS1300070-05 0.02 mg (Baculovirus)

Recombinant Vibrio vulnificus UPF0350 protein VV2841 (VV2841)

Sign In for Pricing
View Details
Recombinant Vibrio vulnificus UPF0350 protein VV2841 (VV2841)
MBS1300070-06 1 mg (E-Coli)

Recombinant Vibrio vulnificus UPF0350 protein VV2841 (VV2841)

Sign In for Pricing
View Details