Zfp583 Peptide - middle region
Zfp583 Peptide - middle region
Product Specifications
Product Name Alternative
BC056221, Znf583
UniProt
Q3V080
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Zfp583 Rabbit Polyclonal Antibody (orb325600) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001028421
Preservative
Lyophilized powder
AA Sequence
ECRKAFSQNAHLAQHQRVHTGEKPYQCKECKKAFSQIAHLTQHQRIHTGE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RC229019L3V 200 µL
PARP9 (NM_001146104) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
249147 50 µL
NAT9 (N-Acetyltransferase 9 (GCN5-Related, Putative), DKFZp564C103, EBSP)
Sign In for Pricing
View Details 
RD-SOX18-Hu-48Tests 48 Tests
Human Sex Determining Region Y Box Protein 18 (SOX18) ELISA Kit
Sign In for Pricing
View Details MBS1489367-01 0.05 mg
Rabbit anti-Bacillus thuringiensis subsp. TenebrionisPesticidal crystal protein cry3Aa polyclonal Antibody, FITC
Sign In for Pricing
View Details