Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFP62 Peptide - C-terminal region

ZFP62 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp667F2013, FLJ11344, FLJ34057, FLJ34231, FLJ58781, FLJ59694, MGC176438, ZET, ZNF755

UniProt

Q8NB50

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZFP62 Rabbit Polyclonal Antibody (orb585534) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689496

Preservative

Lyophilized powder

AA Sequence

NECGKAFNIRSNLTKHKRTHTGEESLNVIYVGSYSGTSQKRTYEGGNALD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLUL Antibody, KO Validated
19-660 100 µL

GLUL Antibody, KO Validated

Sign In for Pricing
View Details
Rat Monoclonal CCL8/MCP-2 Antibody (RM0184-17A2) [FITC]
NBP2-12123F 0.1 mL

Rat Monoclonal CCL8/MCP-2 Antibody (RM0184-17A2) [FITC]

Sign In for Pricing
View Details
Tcl1b5 ORF Vector (Mouse) (pORF)
46403014 1.0 µg DNA

Tcl1b5 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Cutal (NM_030021) Mouse Tagged ORF Clone
MG214533 10 µg

Cutal (NM_030021) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
MRPL37 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV792126 1.0 µg DNA

MRPL37 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Antizyme inhibitor 1 (AZIN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D12]
TA810984AM 100 µL

Antizyme inhibitor 1 (AZIN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D12]

Sign In for Pricing
View Details