Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFP62 Peptide - C-terminal region

ZFP62 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp667F2013, FLJ11344, FLJ34057, FLJ34231, FLJ58781, FLJ59694, MGC176438, ZET, ZNF755

UniProt

Q8NB50

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZFP62 Rabbit Polyclonal Antibody (orb585534) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689496

Preservative

Lyophilized powder

AA Sequence

NECGKAFNIRSNLTKHKRTHTGEESLNVIYVGSYSGTSQKRTYEGGNALD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Anti-Mouse CD24-LE/AF
1590-14 0.5 mg

Rat Anti-Mouse CD24-LE/AF

Sign In for Pricing
View Details
AGXT2L2 Rabbit pAb, Pacific Blue conjugated
orb2888229 100 µL

AGXT2L2 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
Gria2 (NM_001039195) Mouse Tagged ORF Clone Lentiviral Particle
MR227068L4V 200 µL

Gria2 (NM_001039195) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rat Monoclonal P-Cadherin Antibody (106020) [Janelia Fluor 549]
FAB761I 0.1 mL

Rat Monoclonal P-Cadherin Antibody (106020) [Janelia Fluor 549]

Sign In for Pricing
View Details
Human MPRL (Macroprolactin) ELISA Kit
MBS8820689-01 48 Well

Human MPRL (Macroprolactin) ELISA Kit

Sign In for Pricing
View Details
Human MPRL (Macroprolactin) ELISA Kit
MBS8820689-02 96 Well

Human MPRL (Macroprolactin) ELISA Kit

Sign In for Pricing
View Details