Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp664 Peptide - C-terminal region

Zfp664 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AW060232, D930038J03Rik, ZFOC1, Znf664

UniProt

Q4VA44

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zfp664 Rabbit Polyclonal Antibody (orb325678) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001075219

Preservative

Lyophilized powder

AA Sequence

SSLCIHQRVHTGEKPFKCDECGKAFSQSTSLCIHQRVHTKERNHLKISVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pcbp1 Mouse Pre-designed siRNA Set A
HY-RS18184 1 Set

Pcbp1 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
DMU2139
bs-7004C-01 2 mg

DMU2139

Sign In for Pricing
View Details
DMU2139
bs-7004C-02 10 mg

DMU2139

Sign In for Pricing
View Details
2.0 mL self-standing screw cap microcentrifuge tube, graduated, natural with yellow cap, 500/pack
1420-9706 500/PCK

2.0 mL self-standing screw cap microcentrifuge tube, graduated, natural with yellow cap, 500/pack

Sign In for Pricing
View Details
ELISA Kit for Ependymin Related Protein 1 (EPDR1)
TRV-0037590-01 24 Tests

ELISA Kit for Ependymin Related Protein 1 (EPDR1)

Sign In for Pricing
View Details
ELISA Kit for Ependymin Related Protein 1 (EPDR1)
TRV-0037590-02 48 Tests

ELISA Kit for Ependymin Related Protein 1 (EPDR1)

Sign In for Pricing
View Details