Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp72 Peptide - N-terminal region

Zfp72 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Zfp74

UniProt

Q0VFY0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zfp72 Rabbit Polyclonal Antibody (orb581250) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001075149

Preservative

Lyophilized powder

AA Sequence

KECNKTFVRKSLLIQHQRVHTGEKPYKCEQCGKAFSCSSSLTPHQRIHTG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL31RA Rabbit Polyclonal Antibody
TA364854 100 µL

IL31RA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Calponin 1 rabbit pAb
MBS8601821-01 0.1 mL

Calponin 1 rabbit pAb

Sign In for Pricing
View Details
Calponin 1 rabbit pAb
MBS8601821-02 0.1 mL (AF405L)

Calponin 1 rabbit pAb

Sign In for Pricing
View Details
Calponin 1 rabbit pAb
MBS8601821-03 0.1 mL (AF405S)

Calponin 1 rabbit pAb

Sign In for Pricing
View Details
Calponin 1 rabbit pAb
MBS8601821-04 0.1 mL (AF610)

Calponin 1 rabbit pAb

Sign In for Pricing
View Details
Calponin 1 rabbit pAb
MBS8601821-05 0.1 mL (AF635)

Calponin 1 rabbit pAb

Sign In for Pricing
View Details