Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp72 Peptide - N-terminal region

Zfp72 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Zfp74

UniProt

Q0VFY0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zfp72 Rabbit Polyclonal Antibody (orb581250) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001075149

Preservative

Lyophilized powder

AA Sequence

KECNKTFVRKSLLIQHQRVHTGEKPYKCEQCGKAFSCSSSLTPHQRIHTG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HNRPM (HNRNPM) (NM_031203) Human Tagged ORF Clone
RC220513 10 µg

HNRPM (HNRNPM) (NM_031203) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein C713.09 (SPBC713.09)
MBS1455412-01 0.02 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Uncharacterized protein C713.09 (SPBC713.09)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein C713.09 (SPBC713.09)
MBS1455412-02 0.02 mg (Yeast)

Recombinant Schizosaccharomyces pombe Uncharacterized protein C713.09 (SPBC713.09)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein C713.09 (SPBC713.09)
MBS1455412-03 0.1 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Uncharacterized protein C713.09 (SPBC713.09)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein C713.09 (SPBC713.09)
MBS1455412-04 0.1 mg (Yeast)

Recombinant Schizosaccharomyces pombe Uncharacterized protein C713.09 (SPBC713.09)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein C713.09 (SPBC713.09)
MBS1455412-05 0.02 mg (Baculovirus)

Recombinant Schizosaccharomyces pombe Uncharacterized protein C713.09 (SPBC713.09)

Sign In for Pricing
View Details