Zfp759 Peptide - N-terminal region
Zfp759 Peptide - N-terminal region
Product Specifications
Product Name Alternative
Rslcan8, BC028265, Rslcan-8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Zfp759 Rabbit Polyclonal Antibody (orb577351) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
EDL10320
Preservative
Lyophilized powder
AA Sequence
LGPPQWKLYRDVMLENYNNLVFLGLASSKPYLVRFLEQIQEPLDVKSQVA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470266-100 1x 100 µL
Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470226-100 1x 100 µL
Pmel17 / gp100 / SILV (NKI-beteb), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940955-100 1x 100 µL
Mucin 1 / EMA / Episialin / CD227 (MUC1/955), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details