Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp872 Peptide - middle region

Zfp872 Peptide - middle region

Product Specifications

Product Name Alternative

9530015I07Rik

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zfp872 Rabbit Polyclonal Antibody (orb576436) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001028985

Preservative

Lyophilized powder

AA Sequence

CHSEHTQWESHGFRGKLYQCKDCGKAFSFQSSFRIHERTHTGEKPYMCKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAJB4 Antibody
8C12333-AAT 50 µg

DNAJB4 Antibody

Sign In for Pricing
View Details
Kaptin (KPTN) (Center) Rabbit Polyclonal Antibody
AP52403PU-N 400 µL

Kaptin (KPTN) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SLN (NM_003063) Human Over-expression Lysate
LY418924 100 µg

SLN (NM_003063) Human Over-expression Lysate

Sign In for Pricing
View Details
THBS2 Antibody
KC-27476-01 50 μL

THBS2 Antibody

Sign In for Pricing
View Details
THBS2 Antibody
KC-27476-02 100 µL

THBS2 Antibody

Sign In for Pricing
View Details
THBS2 Antibody
KC-27476-03 1 mL

THBS2 Antibody

Sign In for Pricing
View Details