Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp872 Peptide - middle region

Zfp872 Peptide - middle region

Product Specifications

Product Name Alternative

9530015I07Rik

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zfp872 Rabbit Polyclonal Antibody (orb576436) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001028985

Preservative

Lyophilized powder

AA Sequence

CHSEHTQWESHGFRGKLYQCKDCGKAFSFQSSFRIHERTHTGEKPYMCKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NF-kB p65 (RELA) Human Gene Knockout Kit (CRISPR)
KN220780LP 1 Kit

NF-kB p65 (RELA) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1-Bromo-4-isobutylbenzene
TRC-B696380-500MG 500 mg

1-Bromo-4-isobutylbenzene

Sign In for Pricing
View Details
RWDD1 (NM_001007464) Human Over-expression Lysate
LY423486 100 µg

RWDD1 (NM_001007464) Human Over-expression Lysate

Sign In for Pricing
View Details
L-4-Acetylphenylalanine
TRC-A145345-25MG 25 mg

L-4-Acetylphenylalanine

Sign In for Pricing
View Details
TTF-1 / NKX2.1 (8G7G3/1), CF488A conjugate, 0.1mg/mL
BNC880448-100 1x 100 µL

TTF-1 / NKX2.1 (8G7G3/1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SNX1 Human Knockdown Lysate
LY300431 100 µg

SNX1 Human Knockdown Lysate

Sign In for Pricing
View Details