Zhx3 Peptide - C-terminal region
Zhx3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
1810059C13Rik, 4932418O04Rik, 9530010N21Rik, Tix1, mKIAA0395
UniProt
Q8C0Q2
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Zhx3 Rabbit Polyclonal Antibody (orb576340) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_796237
Preservative
Lyophilized powder
AA Sequence
NGEPVAVHKVLGDAYSELSENSESWEPSAPEASSEPFDTSSPQSGRQLEA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC942905-500 1x 500 µL
CD29 (Stem Cell Marker) (12G10), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
KN204260 1 Kit
Acetyl CoA synthetase (ACSS2) Human Gene Knockout Kit (CRISPR)
Sign In for Pricing
View Details 
![Glypican 4 (GPC4) Mouse Monoclonal Antibody [Clone ID: AT51E3]](https://cdn.genprice.uk/products/937/6868b207994c49e6dc1f31f6/imageurl/ap33507pu-s.webp)
AP33507PU-S 50 µL
Glypican 4 (GPC4) Mouse Monoclonal Antibody [Clone ID: AT51E3]
Sign In for Pricing
View Details 
BNUB3641-100 1x 100 µL
Cytochrome C (Mitochondrial Marker) (rCYCS/1010), 0.2mg/mL
Sign In for Pricing
View Details