Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zhx3 Peptide - C-terminal region

Zhx3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1810059C13Rik, 4932418O04Rik, 9530010N21Rik, Tix1, mKIAA0395

UniProt

Q8C0Q2

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zhx3 Rabbit Polyclonal Antibody (orb576340) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_796237

Preservative

Lyophilized powder

AA Sequence

NGEPVAVHKVLGDAYSELSENSESWEPSAPEASSEPFDTSSPQSGRQLEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGFR (GFR1195 + 31G7), 1mg/mL
BNUM1200-50 1x 50 µL

EGFR (GFR1195 + 31G7), 1mg/mL

Sign In for Pricing
View Details
GLIPR1L2 (N-term) Rabbit Polyclonal Antibody
AP51851PU-N 400 µL

GLIPR1L2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human LSAMP Protein (His Tag)
PKSH033342-01 10 µg

Recombinant Human LSAMP Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human LSAMP Protein (His Tag)
PKSH033342-02 50 µg

Recombinant Human LSAMP Protein (His Tag)

Sign In for Pricing
View Details
Tissue FFPE Sections, Liver
CS803216 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS647647 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details