Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zik1 Peptide - C-terminal region

Zik1 Peptide - C-terminal region

Product Specifications

UniProt

Q80YP6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zik1 Rabbit Polyclonal Antibody (orb581069) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033603

Preservative

Lyophilized powder

AA Sequence

KRVHTGERPYKCSECGNSFSQSAILNQHRRIHTGVKPYECRECGKSFSQK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COP (CARD16) (N-term) Rabbit Polyclonal Antibody
AP51022PU-N 400 µL

COP (CARD16) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human CPSF4L activation kit by CRISPRa
GA118675 1 Kit

Human CPSF4L activation kit by CRISPRa

Sign In for Pricing
View Details
Human IGLON5 activation kit by CRISPRa
GA118365 1 Kit

Human IGLON5 activation kit by CRISPRa

Sign In for Pricing
View Details
2-Iodobenzotrifluoride
TRC-I685630-25G 25 g

2-Iodobenzotrifluoride

Sign In for Pricing
View Details
ZNF396 Human Gene Knockout Kit (CRISPR)
KN416400 1 Kit

ZNF396 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TOX3 (TOX3/1124), Biotin conjugate, 0.1mg/mL
BNCB1124-100 1x 100 µL

TOX3 (TOX3/1124), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details