Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zkscan14 Peptide - middle region

Zkscan14 Peptide - middle region

Product Specifications

Product Name Alternative

2310046C23Rik, 2810437E14Rik, MGC117641, Zfp99, Znf394

UniProt

Q9Z1D9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zkscan14 Rabbit Polyclonal Antibody (orb324686) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_075811

Preservative

Lyophilized powder

AA Sequence

SVKPHSSVDSAVGLLETQRQFQEDKPYKCDSCEKGFRQRSDLFKHQRIHT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/3124R), CF640R conjugate, 0.1mg/mL
BNC403124-500 1x 500 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/3124R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EFCAB9 (NM_001171183) Human Over-expression Lysate
LY432671 100 µg

EFCAB9 (NM_001171183) Human Over-expression Lysate

Sign In for Pricing
View Details
Biliverdin Reductase (BLVRA) Rabbit Polyclonal Antibody
TA365522 100 µL

Biliverdin Reductase (BLVRA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
c Fos (FOS) Mouse Monoclonal Antibody [Clone ID: 2G2]
AM06762SU-N 100 µL

c Fos (FOS) Mouse Monoclonal Antibody [Clone ID: 2G2]

Sign In for Pricing
View Details
7-Hydroxy-1,4-benzodioxan-6-carboxylic Acid
TRC-H829190-25MG 25 mg

7-Hydroxy-1,4-benzodioxan-6-carboxylic Acid

Sign In for Pricing
View Details
DNA Ligase III (LIG3) Human Gene Knockout Kit (CRISPR)
KN209530BN 1 Kit

DNA Ligase III (LIG3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details