Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZMAT1 Peptide - middle region

ZMAT1 Peptide - middle region

Product Specifications

Product Name Alternative

KIAA1789, MGC176728

UniProt

A7MD47

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZMAT1 Rabbit Polyclonal Antibody (orb581193) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115817

Preservative

Lyophilized powder

AA Sequence

RMCEQRFSHEASQTYQRPYHISPVESQLPQWLPTHSKRTYDSFQDELEDY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HNF4 gamma (HNF4G) (NM_004133) Human Over-expression Lysate
LY418192 100 µg

HNF4 gamma (HNF4G) (NM_004133) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: bilateral
CR562440 5 µg

Tissue Total RNA, Ovary: bilateral

Sign In for Pricing
View Details
KRTAP2-2 (NM_033032) Human Over-expression Lysate
LC432121 20 µg

KRTAP2-2 (NM_033032) Human Over-expression Lysate

Sign In for Pricing
View Details
Il23a (NM_031252) Mouse Tagged ORF Clone
MG201920 10 µg

Il23a (NM_031252) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS621743 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Human 5 HT1A (HTR1A) activation kit by CRISPRa
GA102279 1 Kit

Human 5 HT1A (HTR1A) activation kit by CRISPRa

Sign In for Pricing
View Details