Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZMAT1 Peptide - middle region

ZMAT1 Peptide - middle region

Product Specifications

Product Name Alternative

KIAA1789, MGC176728

UniProt

A7MD47

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZMAT1 Rabbit Polyclonal Antibody (orb581193) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115817

Preservative

Lyophilized powder

AA Sequence

RMCEQRFSHEASQTYQRPYHISPVESQLPQWLPTHSKRTYDSFQDELEDY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX10 (Melanoma Marker) (rSOX10/1074), CF647 conjugate, 0.1mg/mL
BNC472312-100 1x 100 µL

SOX10 (Melanoma Marker) (rSOX10/1074), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nitrazepam-d5
TRC-N490142-1MG 1 mg

Nitrazepam-d5

Sign In for Pricing
View Details
LDL Receptor (LDLR) (NM_000527) Human Recombinant Protein
TP720505XL 1 mg

LDL Receptor (LDLR) (NM_000527) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Calca activation kit by CRISPRa
GA200495 1 Kit

Mouse Calca activation kit by CRISPRa

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD244 Antibody[C1.7]
E-AB-F1374G-01 20 Tests

PE/Cyanine5 Anti-Human CD244 Antibody[C1.7]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD244 Antibody[C1.7]
E-AB-F1374G-02 100 Tests

PE/Cyanine5 Anti-Human CD244 Antibody[C1.7]

Sign In for Pricing
View Details