Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZMAT2 Peptide - middle region

ZMAT2 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ31121, Snu23, hSNU23, Ptg-12

UniProt

Q96NC0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZMAT2 Rabbit Polyclonal Antibody (orb577918) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653324

Preservative

Lyophilized powder

AA Sequence

KEKQKEKKRRAEEDLTFEEDDEMAAVMGFSGFGSTKKSY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZCCHC10 activation kit by CRISPRa
GA110284 1 Kit

Human ZCCHC10 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS625523 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
EWSR1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B3]
TA813053BM 100 µL

EWSR1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B3]

Sign In for Pricing
View Details
Sonic Hedgehog (SHH) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI10H6]
TA500041AM 100 µL

Sonic Hedgehog (SHH) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI10H6]

Sign In for Pricing
View Details
Aurora B (Proliferation Marker) (rAURKB/1592), CF740 conjugate, 0.1mg/mL
BNC743787-500 1x 500 µL

Aurora B (Proliferation Marker) (rAURKB/1592), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BCL10 Polyclonal Antibody
E-AB-10997-01 20 µL

BCL10 Polyclonal Antibody

Sign In for Pricing
View Details