Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZMAT2 Peptide - middle region

ZMAT2 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ31121, Snu23, hSNU23, Ptg-12

UniProt

Q96NC0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZMAT2 Rabbit Polyclonal Antibody (orb577918) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653324

Preservative

Lyophilized powder

AA Sequence

KEKQKEKKRRAEEDLTFEEDDEMAAVMGFSGFGSTKKSY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLAMF8 Polyclonal Antibody
E-AB-11004-01 20 µL

SLAMF8 Polyclonal Antibody

Sign In for Pricing
View Details
SLAMF8 Polyclonal Antibody
E-AB-11004-02 60 µL

SLAMF8 Polyclonal Antibody

Sign In for Pricing
View Details
SLAMF8 Polyclonal Antibody
E-AB-11004-03 120 µL

SLAMF8 Polyclonal Antibody

Sign In for Pricing
View Details
SLAMF8 Polyclonal Antibody
E-AB-11004-04 200 µL

SLAMF8 Polyclonal Antibody

Sign In for Pricing
View Details
Tryptase (Mast Cell Marker) (TPSAB1/1961), CF405S conjugate, 0.1mg/mL
BNC041961-500 1x 500 µL

Tryptase (Mast Cell Marker) (TPSAB1/1961), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS716847 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details