Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF101 Peptide - N-terminal region

ZNF101 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp570I0164, HZF12, MGC149565, MGC149566

UniProt

Q8IZC7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF101 Rabbit Polyclonal Antibody (orb575796) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_149981

Preservative

Lyophilized powder

AA Sequence

EWALLSPSQKNLYRDVTLETFRNLASVGIQWKDQDIENLYQNLGIKLRSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phenylglyoxylic Acid-d5
TRC-P327502-5MG 5 mg

Phenylglyoxylic Acid-d5

Sign In for Pricing
View Details
GRK5 Human Gene Knockout Kit (CRISPR)
KN209137 1 Kit

GRK5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human ALDH3A1 Protein (Baculovirus, His Tag)
PKSH030821 50 µg

Recombinant Human ALDH3A1 Protein (Baculovirus, His Tag)

Sign In for Pricing
View Details
Cdk2 / p34cdc2 Serine-Threonine Kinase (AN4.3), CF640R conjugate, 0.1mg/mL
BNC402316-500 1x 500 µL

Cdk2 / p34cdc2 Serine-Threonine Kinase (AN4.3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Iodoethane-d5 (stabilized with Copper wire)
TRC-I705872-1G 1 g

Iodoethane-d5 (stabilized with Copper wire)

Sign In for Pricing
View Details
SEPTIN7 Rabbit Polyclonal Antibody
TA392877 100 µL

SEPTIN7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details