Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF101 Peptide - N-terminal region

ZNF101 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp570I0164, HZF12, MGC149565, MGC149566

UniProt

Q8IZC7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF101 Rabbit Polyclonal Antibody (orb575796) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_149981

Preservative

Lyophilized powder

AA Sequence

EWALLSPSQKNLYRDVTLETFRNLASVGIQWKDQDIENLYQNLGIKLRSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CIP2A Recombinant Rabbit monoclonal Antibody
HA751590 100 µL

CIP2A Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Fmoc-hydrazino TentaGel® TRT Resin
S30070.1G 1 g

Fmoc-hydrazino TentaGel® TRT Resin

Sign In for Pricing
View Details
LINC02145 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8C7]
TA810701BM 100 µL

LINC02145 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8C7]

Sign In for Pricing
View Details
Recombinant pTau404 Antibody
RC-4157-01 50 μL

Recombinant pTau404 Antibody

Sign In for Pricing
View Details
Recombinant pTau404 Antibody
RC-4157-02 100 µL

Recombinant pTau404 Antibody

Sign In for Pricing
View Details
Recombinant pTau404 Antibody
RC-4157-03 1 mL

Recombinant pTau404 Antibody

Sign In for Pricing
View Details