Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF135 Peptide - N-terminal region

ZNF135 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ZNF61, ZNF78L1, pHZ-17, pT3

UniProt

P52742

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF135 Rabbit Polyclonal Antibody (orb575580) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003427

Preservative

Lyophilized powder

AA Sequence

ELWAVESRLPQGVYPDLETRPKVKLSVLKQGISEEISNSVILVERFLWDG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCM3 Rabbit Polyclonal Antibody
TA384765 100 µL

MCM3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Vertical Laminar Airflow BLVR-305
BLVR-305 Each

Vertical Laminar Airflow BLVR-305

Sign In for Pricing
View Details
CDC25A (N-term) Rabbit Polyclonal Antibody
AP13254PU-N 400 µL

CDC25A (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIGHM/2558), CF647 conjugate, 0.1mg/mL
BNC472558-100 1x 100 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIGHM/2558), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NSUN6 Human Gene Knockout Kit (CRISPR)
KN207817BN 1 Kit

NSUN6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SSB (NM_003142) Human Over-expression Lysate
LY401091 100 µg

SSB (NM_003142) Human Over-expression Lysate

Sign In for Pricing
View Details