Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF135 Peptide - N-terminal region

ZNF135 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ZNF61, ZNF78L1, pHZ-17, pT3

UniProt

P52742

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF135 Rabbit Polyclonal Antibody (orb575580) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003427

Preservative

Lyophilized powder

AA Sequence

ELWAVESRLPQGVYPDLETRPKVKLSVLKQGISEEISNSVILVERFLWDG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LOC100287036 activation kit by CRISPRa
GA119203 1 Kit

Human LOC100287036 activation kit by CRISPRa

Sign In for Pricing
View Details
C22 Dihydroceramide
TRC-C263145-50MG 50 mg

C22 Dihydroceramide

Sign In for Pricing
View Details
APC Anti-Human CD49d Antibody[9F10]
E-AB-F1144E-01 20 Tests

APC Anti-Human CD49d Antibody[9F10]

Sign In for Pricing
View Details
APC Anti-Human CD49d Antibody[9F10]
E-AB-F1144E-02 100 Tests

APC Anti-Human CD49d Antibody[9F10]

Sign In for Pricing
View Details
APC Anti-Human CD49d Antibody[9F10]
E-AB-F1144E-03 2x 100 Tests

APC Anti-Human CD49d Antibody[9F10]

Sign In for Pricing
View Details
SLP76 Recombinant Rabbit monoclonal Antibody
HA723080 100 µL

SLP76 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details