Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF232 Peptide - N-terminal region

ZNF232 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ZSCAN11

UniProt

Q9UNY5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF232 Rabbit Polyclonal Antibody (orb575680) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055334

Preservative

Lyophilized powder

AA Sequence

AAETLALQGTQGQEKMMMMGPKEEEQSCEYETRLPGNHSTSQEIFRQRFR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

10b-Hydroxy D-(-)-Norgestrel
TRC-H825710-5MG 5 mg

10b-Hydroxy D-(-)-Norgestrel

Sign In for Pricing
View Details
Lentiviral mouse Ubr5 shRNA (UAS) - Lentiviral mouse Ubr5 shRNA (UAS, GFP) (100)
GTR15275601 1 Vial

Lentiviral mouse Ubr5 shRNA (UAS) - Lentiviral mouse Ubr5 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
ZapA Antibody
orb836968 2 mg

ZapA Antibody

Sign In for Pricing
View Details
Goat resolvin D1 (RvD1) ELISA Kit
EIA06548Go 1 Kit

Goat resolvin D1 (RvD1) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Hamp2 shRNA (UAS) - Lentiviral mouse Hamp2 shRNA (UAS, GFP) (100)
GTR15202017 1 Vial

Lentiviral mouse Hamp2 shRNA (UAS) - Lentiviral mouse Hamp2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
KCNMB3 Polyclonal Antibody
MBS2528758-01 0.02 mL

KCNMB3 Polyclonal Antibody

Sign In for Pricing
View Details