Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF232 Peptide - N-terminal region

ZNF232 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ZSCAN11

UniProt

Q9UNY5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF232 Rabbit Polyclonal Antibody (orb575680) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055334

Preservative

Lyophilized powder

AA Sequence

AAETLALQGTQGQEKMMMMGPKEEEQSCEYETRLPGNHSTSQEIFRQRFR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nylon, 0.22μm, sterile filter funnel with 500 ml solvent bottle
ZG-NL-22-500 1pcs/bag,12bags/ctn

Nylon, 0.22μm, sterile filter funnel with 500 ml solvent bottle

Sign In for Pricing
View Details
Endothelin B Receptor (EDNRB) (NM_001122659) Human Over-expression Lysate
LC426542 20 µg

Endothelin B Receptor (EDNRB) (NM_001122659) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Pig IL33/ Interleukin-33/ NF-HEV Protein Protein, GST, E.coli-50ug
QP6221-ec-50ug 50ug

Recombinant Pig IL33/ Interleukin-33/ NF-HEV Protein Protein, GST, E.coli-50ug

Sign In for Pricing
View Details
Larp4 (NM_001284521) Mouse Untagged Clone
MC228600 10 µg

Larp4 (NM_001284521) Mouse Untagged Clone

Sign In for Pricing
View Details
Dusigitumab (Biosimilar Reference Antibody) (IGF1 and IGF2)
RA0314-01 100 µg

Dusigitumab (Biosimilar Reference Antibody) (IGF1 and IGF2)

Sign In for Pricing
View Details
Dusigitumab (Biosimilar Reference Antibody) (IGF1 and IGF2)
RA0314-02 1 mg

Dusigitumab (Biosimilar Reference Antibody) (IGF1 and IGF2)

Sign In for Pricing
View Details