Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF277 Peptide - N-terminal region

ZNF277 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NRIF4, ZNF277P

UniProt

Q9NRM2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF277 Rabbit Polyclonal Antibody (orb577164) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_068834

Preservative

Lyophilized powder

AA Sequence

MAASKTQGAVARMQEDRDGSCSTVGGVGYGDSKDCILEPLSLPESPGGTT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDLIM4 Polyclonal Antibody
E-AB-11541-01 20 µL

PDLIM4 Polyclonal Antibody

Sign In for Pricing
View Details
PDLIM4 Polyclonal Antibody
E-AB-11541-02 60 µL

PDLIM4 Polyclonal Antibody

Sign In for Pricing
View Details
PDLIM4 Polyclonal Antibody
E-AB-11541-03 120 µL

PDLIM4 Polyclonal Antibody

Sign In for Pricing
View Details
PDLIM4 Polyclonal Antibody
E-AB-11541-04 200 µL

PDLIM4 Polyclonal Antibody

Sign In for Pricing
View Details
CNPY1 Human Gene Knockout Kit (CRISPR)
KN415924 1 Kit

CNPY1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant HBEGF Antibody
RC-5080-01 50 μL

Recombinant HBEGF Antibody

Sign In for Pricing
View Details