Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF277 Peptide - N-terminal region

ZNF277 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NRIF4, ZNF277P

UniProt

Q9NRM2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF277 Rabbit Polyclonal Antibody (orb577164) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_068834

Preservative

Lyophilized powder

AA Sequence

MAASKTQGAVARMQEDRDGSCSTVGGVGYGDSKDCILEPLSLPESPGGTT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein A Texas Red Colloidal Gold, 1mL 20nm
TGP-01-20 1 mL

Protein A Texas Red Colloidal Gold, 1mL 20nm

Sign In for Pricing
View Details
CHRM2 Rabbit Polyclonal Antibody
AP01304PU-N 100 µg

CHRM2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IgA Secretory Component (ECM1/792), Biotin conjugate, 0.1mg/mL
BNCB0792-500 1x 500 µL

IgA Secretory Component (ECM1/792), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
QuicKey Pro Mouse CRP (C-Reactive Protein) ELISA Kit
E-OSEL-M0016-01 24 Tests

QuicKey Pro Mouse CRP (C-Reactive Protein) ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Mouse CRP (C-Reactive Protein) ELISA Kit
E-OSEL-M0016-02 48 Tests

QuicKey Pro Mouse CRP (C-Reactive Protein) ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Mouse CRP (C-Reactive Protein) ELISA Kit
E-OSEL-M0016-03 96 Tests

QuicKey Pro Mouse CRP (C-Reactive Protein) ELISA Kit

Sign In for Pricing
View Details