Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF313 Peptide - C-terminal region

ZNF313 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PSORS12, ZNF313

UniProt

Q9Y508

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF313 Rabbit Polyclonal Antibody (orb577085) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061153

Preservative

Lyophilized powder

AA Sequence

VVCPICASMPWGDPNYRSANFREHIQRRHRFSYDTFVDYDVDEEDMMNQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kinesin Family Member 17 (KIF17) Antibody
abx113379 100 µL

Kinesin Family Member 17 (KIF17) Antibody

Sign In for Pricing
View Details
Phospho-L-arginine Trisodium Salt
TRC-P354000-1MG 1 mg

Phospho-L-arginine Trisodium Salt

Sign In for Pricing
View Details
Human Granulocyte-Colony Stimulating Factor (Recombinant)
22060084-3 1 mg

Human Granulocyte-Colony Stimulating Factor (Recombinant)

Sign In for Pricing
View Details
PIAS3 Rabbit Polyclonal Antibody
TA331151 100 µL

PIAS3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Med19 Antibody
GWB-MT917H 50 µg

Med19 Antibody

Sign In for Pricing
View Details
Human MMP-8 enzyme-linked immunoassay kit
EH0103 96 Tests

Human MMP-8 enzyme-linked immunoassay kit

Sign In for Pricing
View Details