ZNF320 Peptide - N-terminal region
ZNF320 Peptide - N-terminal region
Product Specifications
Product Name Alternative
DKFZp686G16228, ZFPL
UniProt
A2RRD8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF320 Rabbit Polyclonal Antibody (orb581256) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_997216
Preservative
Lyophilized powder
AA Sequence
NDHEAPMTEIKKLTSSTDRYDQRHAGNKPIKGQLESRFHLHLRRHRRIHT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
#92232 1 Kit
Mix-n-StainTM CF®405M Antibody Labeling Kit, 1x (50-100ug) labeling
Sign In for Pricing
View Details 
BNC940411-500 1x 500 µL
BCL-10 (BL10/411), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
E-EL-H1007-01 24 Tests
Human βTG/PBP/CXCL7/NAP2 (Thromboglobulin, Beta) ELISA Kit
Sign In for Pricing
View Details E-EL-H1007-02 48 Tests
Human βTG/PBP/CXCL7/NAP2 (Thromboglobulin, Beta) ELISA Kit
Sign In for Pricing
View Details