Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF320 Peptide - N-terminal region

ZNF320 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp686G16228, ZFPL

UniProt

A2RRD8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF320 Rabbit Polyclonal Antibody (orb581256) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997216

Preservative

Lyophilized powder

AA Sequence

NDHEAPMTEIKKLTSSTDRYDQRHAGNKPIKGQLESRFHLHLRRHRRIHT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EEF2 Mouse Monoclonal Antibody [Clone ID: 5B6]
AM06603SU-N 100 µL

EEF2 Mouse Monoclonal Antibody [Clone ID: 5B6]

Sign In for Pricing
View Details
Rhox13 Mouse Gene Knockout Kit (CRISPR)
KN514783 1 Kit

Rhox13 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Plakophilin 3 Rabbit Polyclonal Antibody
HA500034 100 µL

Plakophilin 3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AF10 (MLLT10) Rabbit Polyclonal Antibody
TA368904 100 µL

AF10 (MLLT10) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Letermovir
TRC-L321005-10MG 10 mg

Letermovir

Sign In for Pricing
View Details
PSMD1 (NM_002807) Human Over-expression Lysate
LC400995 20 µg

PSMD1 (NM_002807) Human Over-expression Lysate

Sign In for Pricing
View Details