Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF37A Peptide - middle region

ZNF37A Peptide - middle region

Product Specifications

Product Name Alternative

FLJ3472, KOX21, ZNF37

UniProt

P17032

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF37A Rabbit Polyclonal Antibody (orb580081) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001007095

Preservative

Lyophilized powder

AA Sequence

QQRTHTGEKPYECHECGKTFTQKSAHTRHQRTHTGGKPYECHECGKTFYK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nociceptin (1-13) amide TFA
orb1296505-01 1 mg

Nociceptin (1-13) amide TFA

Sign In for Pricing
View Details
Nociceptin (1-13) amide TFA
orb1296505-02 5 mg

Nociceptin (1-13) amide TFA

Sign In for Pricing
View Details
Nociceptin (1-13) amide TFA
orb1296505-03 10 mg

Nociceptin (1-13) amide TFA

Sign In for Pricing
View Details
Nociceptin (1-13) amide TFA
orb1296505-04 25 mg

Nociceptin (1-13) amide TFA

Sign In for Pricing
View Details
Nociceptin (1-13) amide TFA
orb1296505-05 50 mg

Nociceptin (1-13) amide TFA

Sign In for Pricing
View Details
Nociceptin (1-13) amide TFA
orb1296505-06 100 mg

Nociceptin (1-13) amide TFA

Sign In for Pricing
View Details