ZNF37A Peptide - middle region
ZNF37A Peptide - middle region
Product Specifications
Product Name Alternative
FLJ3472, KOX21, ZNF37
UniProt
P17032
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF37A Rabbit Polyclonal Antibody (orb580081) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001007095
Preservative
Lyophilized powder
AA Sequence
QQRTHTGEKPYECHECGKTFTQKSAHTRHQRTHTGGKPYECHECGKTFYK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A00244-2-APC 100 µg/Vial
Anti-DDX58 Antibody Picoband® (APC Conjugate)
Sign In for Pricing
View Details 
GTR15244550 1 Vial
Lentiviral mouse Fndc3a shRNA (UAS) - Lentiviral mouse Fndc3a shRNA (UAS, iRFP) (25)
Sign In for Pricing
View Details K0928208 1.0 µg DNA
HAMP sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
Sign In for Pricing
View Details