Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF37A Peptide - middle region

ZNF37A Peptide - middle region

Product Specifications

Product Name Alternative

FLJ3472, KOX21, ZNF37

UniProt

P17032

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF37A Rabbit Polyclonal Antibody (orb580082) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001007095

Preservative

Lyophilized powder

AA Sequence

ECGKSFSEKSTLTQHQRTHTGEKPYECHECGKTFSFKSVLTVHQKTHTGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C6orf227 3'UTR Luciferase Stable Cell Line
TU002458 1.0 mL

C6orf227 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
GATA3 Rabbit Monoclonal Antibody
TA423068 100 µL

GATA3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Bovine Amphiphysin (AMPH) ELISA kit
GTR10421428 96 Well

Bovine Amphiphysin (AMPH) ELISA kit

Sign In for Pricing
View Details
Recombinant human MMP-23B protein
ATGP2660-500 500 µg

Recombinant human MMP-23B protein

Sign In for Pricing
View Details
Human PPARD Knockout A549 cell line
GTR15415856 1 Vial

Human PPARD Knockout A549 cell line

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Transcription elongation factor 1 homolog (elof1)
MBS1307122-01 0.02 mg (E-Coli)

Recombinant Dictyostelium discoideum Transcription elongation factor 1 homolog (elof1)

Sign In for Pricing
View Details